PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013610977.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 127aa    MW: 14470.9 Da    PI: 8.4736
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013610977.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26082.66e-26121121101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +C++C  +++ C+k+C +a yfp+e +++++++ klFG++n+++++k +++e+ + ++ss++ e+ a+++d ++G +gvi+kl ++++ +++ l+
  XP_013610977.1  12 RCCVCIEKNKICTKKCEFAAYFPNEVQSDYEAATKLFGTTNIISMMKLASHEQNHLLASSILKEGAAWTDDNIRGGYGVIQKLMWEIKLHESYLS 106
                     6********************************************************************************************** PP

          DUF260  96 llkeel 101
                     ++k+++
  XP_013610977.1 107 KIKKKI 112
                     999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.25811112IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-2112109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MEALGTDIKH GRCCVCIEKN KICTKKCEFA AYFPNEVQSD YEAATKLFGT TNIISMMKLA  60
SHEQNHLLAS SILKEGAAWT DDNIRGGYGV IQKLMWEIKL HESYLSKIKK KISEEKKQIV  120
LLLNQYI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610977.12e-90PREDICTED: LOB domain-containing protein 5-like
SwissprotQ9C8V81e-39LBD5_ARATH; LOB domain-containing protein 5
TrEMBLA0A078JEG26e-82A0A078JEG2_BRANA; BnaUnng01320D protein
STRINGAT1G36000.13e-37(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122821432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G36000.11e-40LOB domain-containing protein 5